Grilled Chicken Wraps | Savoryte
30-MINUTE MEALS! Get the email series now
Savoryte

Grilled Chicken Wraps

5 from 1 vote
1 Comments
Sophia
By: SophiaUpdated: Jun 30, 2026
This post may contain affiliate links. Please read our disclosure policy.

Quick, melty chicken wraps with crisp lettuce and tangy sauce, grilled in minutes for a weeknight dinner everyone devours.

Grilled Chicken Wraps
This quick chicken wrap has saved more weeknights in my house than I can count. I first pulled it together after a long soccer practice when everyone was hungry and the fridge looked uninspiring. I had leftover shredded chicken, a handful of romaine, and a bottle of sauce that my kids love, and fifteen minutes later we were biting into warm, toasty wraps with melty cheese and a little crunch from the lettuce. The balance is everything: juicy chicken, creamy sauce, and a lightly crisp tortilla from a quick turn on the grill. What makes this especially special to me is how adaptable it is. Sometimes I use rotisserie chicken, sometimes leftover grilled breasts, and other times I cook a quick batch of shredded chicken in advance to keep things easy. The texture contrast is the clincher: warm tortillas with a golden finish, cool lettuce and tomato, and the savory tug of Colby Jack that melts just enough to hold everything together. The smell when these hit the grill is the kind that brings people into the kitchen, asking when dinner will be ready.

Why You'll Love This Recipe

  • Truly fast: on the table in about 25 minutes from start to finish, perfect for busy weeknights.
  • Uses convenient ingredients: leftover or rotisserie chicken, store-bought sauce, and everyday produce you likely have on hand.
  • Family-friendly flavors: creamy, tangy sauce and mild, melty cheese make it a crowd-pleaser for both kids and adults.
  • Flexible cooking method: grill, grill pan, or skillet all work; minimal cleanup with just one pan.
  • Make-ahead friendly: prep fillings in the morning and assemble just before dinner for maximum speed.
  • Customizable: swap sauces, add extras like avocado or bacon, or go spicy with jalapeños.

My family never complains when these hit the menu. I have learned to set out a little toppings bar so everyone can assemble their own, which makes dinner feel fun even on a Monday. The slight char from the grill brings restaurant-style flair without extra effort, and the warm-cheesy center guarantees empty plates.

Ingredients

  • Cooked chicken (2 cups): Shredded rotisserie or leftover grilled chicken works best. Look for tender, well-seasoned meat and shred it so it nestles into the wrap without poking through the tortilla.
  • Romaine lettuce (2 cups, chopped): Crisp romaine keeps its crunch even after grilling. Choose firm, deep green hearts, dry well, and chop into small pieces for even distribution.
  • Roma tomatoes (2, diced): Firm Romas are less watery, which prevents soggy wraps. Seed if extra juicy, and dice small so they tuck neatly into the roll.
  • Red onion (1/2 small, finely diced): A little goes a long way. Finely dicing ensures a balanced bite without overpowering the wrap. Rinse if you prefer a milder bite.
  • Colby Jack cheese (1 cup, finely shredded): Melts smoothly and adds a mild, creamy richness. Finely shredded cheese melts faster, helping glue the wrap together on the grill.
  • Chick Fil A Sauce (1/2 cup): Brings a balanced mix of tangy, smoky, and sweet. Use your favorite copycat or a creamy BBQ-mayo blend for a similar vibe.
  • Flour tortillas (4, 9-inch): Burrito-size tortillas give you room to fold and roll. Choose soft, fresh tortillas and warm slightly so they roll without tearing.

Instructions

Preheat the grill or pan: Heat a grill or grill pan to medium-low. You want enough heat to toast the tortillas and melt the cheese without scorching. If using a skillet, warm it to medium and keep a close eye on browning. Lightly oil the grates or pan just before cooking to prevent sticking. Assemble the wraps: Lay the tortillas on a board. Divide chicken, romaine, tomatoes, onion, and cheese evenly among them, keeping fillings centered and leaving a 2-inch border on all sides. Drizzle about 2 tablespoons of sauce over each. For the neatest wrap, layer cheese close to the tortilla so it melts into a seal when grilled. Fold and roll tightly: Fold the left and right sides in by about 2 inches, then roll from the bottom up, tucking as you go to create a firm cylinder. Place seam side down and press gently so the seam adheres. If tortillas are stiff, warm them 10 to 15 seconds per side in a dry pan first. Grill to finish: Lightly grease the grill grates. Place wraps seam side down and cook 2 minutes per side, until lightly golden with faint grill marks and the cheese is melted. Rotate as needed for even browning. Serve immediately while warm and crisp outside with a cool, crunchy interior. Grilled chicken wraps sliced on a board with lettuce and sauce

You Must Know

  • Warm tortillas briefly so they roll without cracking.
  • Keep fillings moderate; overfilling causes tearing and uneven browning.
  • Place cheese near the tortilla so it melts and helps seal the seam.
  • Use pre-cooked chicken at a safe 165°F; you are just reheating and melting.
  • Leftovers reheat best in a skillet over medium heat 2 to 3 minutes per side.

My favorite part is the first bite: a gentle crunch from the toasted tortilla followed by creamy sauce and melted cheese. This has become our Friday night fallback when energy is low but appetites are high. I often double the batch, slice the wraps on the diagonal, and set them out with extra sauce for dipping. Somehow, those diagonal cuts make them feel party-ready even when it is just us around the table.

Storage Tips

If you anticipate leftovers, store fillings separately to preserve lettuce crunch. Assembled, ungrilled wraps can be refrigerated up to 12 hours tightly wrapped in plastic, then grilled just before serving. Grilled wraps keep 1 to 2 days in the refrigerator in an airtight container. Reheat in a skillet or grill pan over medium heat 2 to 3 minutes per side to re-crisp the tortilla. Freezing is possible without lettuce and tomato; wrap cooled grilled wraps in foil, place in a freezer bag, and freeze up to 2 months. Thaw overnight in the refrigerator and reheat on a skillet until warmed through.

Ingredient Substitutions

Swap the sauce with ranch, chipotle mayo, or a 50/50 blend of BBQ sauce and mayonnaise for a similar creamy, smoky profile. Use sharp cheddar or pepper jack in equal amounts if you prefer more bite or heat. Whole wheat tortillas work well; gluten-free tortillas can be used but are more fragile, so warm them longer and roll gently. For dairy-free, omit the cheese and choose a vegan mayo-based sauce. If you are out of romaine, shredded iceberg or a cabbage slaw adds great crunch. No rotisserie on hand? Poach two medium chicken breasts, shred, and season lightly with salt and pepper.

Serving Suggestions

For a weeknight plate, serve these wraps with a simple corn and avocado salad or a bowl of fruit. When company comes over, slice each wrap on the diagonal and arrange on a platter with extra sauce, pickled jalapeños, and lime wedges. A sprinkle of chopped cilantro and a light dusting of chili powder over the platter adds color and a hint of heat. Pair with sparkling water and lemon for a fresh contrast or a crisp lager for game night.

Close-up of a sliced chicken wrap with melty cheese and romaine

Cultural Background

While wraps as we know them took off in the 1990s in the United States, they borrow from a long lineage of handheld meals that pair bread with fillings: burritos from Mexican cuisine, Middle Eastern shawarma and falafel in pita, and Turkish dürüm. The appeal is universal: something warm to hold, something flavorful inside, and a portable format that suits busy days. Today, the American-style grilled wrap is a staple on cafe menus, combining convenience with a lightly charred finish that feels a touch indulgent.

Meal Prep Tips

Cook and shred chicken up to three days ahead and refrigerate. Chop lettuce and onion the morning of (or the night before if you spin lettuce very dry). Dice tomatoes close to serving to keep them firm. Pre-portion fillings into four containers for easy assembly. Assemble wraps just before grilling for the best texture, or build and wrap tightly in plastic up to 12 hours ahead. For office lunches, grill, cool, and wrap in foil; rewarm on a sandwich press or skillet until crisp.

Stacked chicken wraps on a platter with dipping sauce

These grilled chicken wraps are the kind of easy dinner that turns a hectic day around. Keep the ingredients on hand, let the grill kiss those tortillas, and sit down to a satisfying meal that tastes like more effort than it takes. Make it your own with favorite sauces and add-ins, and enjoy every bite.

Pro Tips

  • Warm tortillas 10 to 15 seconds per side in a dry pan to prevent tears.

  • Place cheese closest to the tortilla so it melts into a seal.

  • Do not overfill; aim for about 1 cup total filling per wrap.

  • Grill seam side down first for a tighter seal and cleaner browning.

  • Dry lettuce thoroughly to keep wraps crisp inside.

  • Use rotisserie chicken for the fastest prep without sacrificing flavor.

This nourishing grilled chicken wraps recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

Can I use gluten-free tortillas?

Yes, but they can crack more easily. Warm them well, roll gently, and skip or reduce juicy fillings for best results.

Do these wraps freeze well?

Assembled wraps without lettuce and tomato freeze better. Cool, wrap in foil, place in a freezer bag, and freeze up to 2 months.

What if I do not have a grill?

Use a nonstick skillet or grill pan over medium-low. Lightly oil the surface, cook 2 minutes per side, and watch for golden spots.

How do I keep wraps from unrolling?

Avoid overfilling, warm tortillas briefly, place cheese near the tortilla to act as glue, and start grilling seam side down.

Tags

Quick & Easy Mealschickenwrapsquick dinnerweeknightgrillfamily-friendlylunch
No ratings yet

Grilled Chicken Wraps

This Grilled Chicken Wraps recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Grilled Chicken Wraps
Prep:PT15M
Cook:PT6M
Rest Time:10 mins
Total:PT21M

Ingredients

Wraps

Instructions

1

Preheat grill or pan

Heat grill or grill pan to medium-low. Lightly oil the grates or pan just before cooking to prevent sticking.

2

Assemble fillings

Divide chicken, romaine, tomatoes, onion, and cheese evenly among tortillas, keeping a 2-inch border. Drizzle each with sauce.

3

Fold and roll

Fold sides in about 2 inches, then roll up tightly from the bottom. Place seam side down and press gently to seal.

4

Grill and serve

Cook wraps seam side down for 2 minutes per side until golden with light grill marks and cheese is melted. Serve hot.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 0kcal | Carbohydrates: 0g | Protein:
0g | Fat: 0g | Saturated Fat: 0g |
Polyunsaturated Fat: 0g | Monounsaturated Fat:
0g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@savoryte on social media!

Grilled Chicken Wraps

Categories:

Grilled Chicken Wraps

Did You Make This?

Leave a comment & rating below or tag @savoryte on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Sophia!

Chef and recipe creator specializing in delicious Quick & Easy Meals cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.