Creamy Carbonara Pasta Recipe - Quick Weeknight Dinner
30-MINUTE MEALS! Get the email series now
Savoryte

Creamy Carbonara Pasta

5 from 1 vote
1 Comments
Sophia
By: SophiaUpdated: Aug 28, 2026
This post may contain affiliate links. Please read our disclosure policy.

A fast, silky carbonara with eggs, pecorino, and crispy bacon that comes together in 20 minutes — perfect for a comforting weeknight dinner.

Creamy Carbonara Pasta
This carbonara pasta is one of those simple, satisfying dishes that has a way of turning an ordinary weeknight into a special occasion. I discovered this particular balance of whole eggs and additional yolks during a rainy evening when the pantry was modest but the craving for something rich and comforting was strong. The result was a glossy, clingy sauce that coats each strand of pasta without any cream, just eggs, cheese, starchy pasta water and rendered bacon fat. The contrast between the silky sauce and the crisp bacon is what makes this dish memorable for my family. Over the years I have learned that timing and mise en place are everything with this dish. Have the beaten eggs and grated cheese ready, the pasta water reserved, and the bacon perfectly crisp before combining. When served hot from the pan, this carbonara has a luxurious texture and a salty, nutty flavor from pecorino Romano that keeps everyone at the table quiet while they eat. It is easy to scale up for a crowd, and because it comes together in about 20 minutes it has become my go-to for hosting when time is short.

Why You'll Love This Recipe

  • This comes together in roughly 20 minutes, so it is ideal for busy weeknights when you want a restaurant-quality dish without the fuss.
  • Uses pantry staples and simple ingredients: eggs, high-quality Pecorino Romano, dried linguine and bacon or guanciale for authentic flavor.
  • The method requires no cream; the sauce relies on eggs and starchy pasta water for a glossy, silk-like coating that clings to each noodle.
  • Make-ahead friendly components: cook the bacon and grate the cheese in advance to speed final assembly and reduce active time.
  • Family-friendly and crowd-pleasing: salty, cheesy and texturally balanced between creamy sauce and crunchy bacon.
  • Flexible for dietary tweaks: swap bacon for pancetta or smoked tempeh for different flavor profiles.

I first served this version to friends who expected something ordinary and left impressed by how rich and layered the flavors were. My teenagers ask for it on folded laundry days and my partner mentions the first bite like it is a culinary highlight. The technique taught me to respect heat control; gently using the pasta heat rather than direct pan heat keeps the eggs silky rather than scrambled.

Ingredients

  • Large eggs and additional yolks: Using three whole eggs plus three extra yolks adds body and richness without making the sauce heavy. Room temperature eggs emulsify better with the warm pasta and starchy water.
  • Pecorino Romano cheese: 1 1/4 cups finely grated, divided. Choose a high-quality aged Pecorino, such as a domestic artisanal wedge or imported Pecorino Romano, and grate fresh for the best flavor and melting properties.
  • Linguine: 16 ounces dried linguine provides the ideal surface area for the sauce to cling. Use a reputable brand like De Cecco or Barilla for consistent texture when cooked al dente.
  • Bacon: 1/2 pound diced bacon yields the savory, crisp element. Thick-cut smoked bacon works well, but for a more authentic Roman approach use pancetta or guanciale if available.
  • Garlic and black pepper: 2 teaspoons fresh minced garlic brightens the rendered fat; 1/4 teaspoon coarse black pepper contributes a warm bite. Freshly cracked pepper is best.
  • Salt and water for pasta: 10 cups water and 1 tablespoon salt to season the pasta cooking liquid thoroughly; reserve 1 to 1 1/2 cups of the starchy pasta water to adjust sauce texture.
  • Fresh parsley: 1 to 2 tablespoons chopped to finish, adding color and a mild herbaceous note that balances the richness.

Instructions

Prepare the egg and cheese emulsion: In a medium mixing bowl, whisk together 3 whole room-temperature eggs, 3 additional room-temperature yolks, 1/4 teaspoon freshly ground black pepper and 1 cup of the grated Pecorino Romano until smooth. The mixture should be cohesive and slightly thick. Set aside near the stove so it can be added quickly when the pasta is ready. Cook the pasta: Bring 10 cups of water and 1 tablespoon salt to a rolling boil in an 8-quart pot. Add 16 ounces linguine and cook until al dente, testing two minutes before package directions. Timing is critical; the pasta should retain a slight bite because carryover heat will finish it in the pan as you toss with the sauce. Crisp the bacon: While the pasta cooks, heat a large 12-inch skillet over medium. Add 1/2 pound diced bacon and cook 9 to 11 minutes stirring often until golden and crisp. Remove bacon with a slotted spoon to a bowl, leaving the rendered fat in the skillet. Monitor the bacon closely to avoid burning and adjust heat if needed. Infuse the fat with garlic: Turn the skillet heat off and add 2 teaspoons minced fresh garlic to the warm rendered fat. Stir for about 1 minute until fragrant; residual heat will soften the garlic without browning it and will preserve a clean garlic flavor. Combine pasta and fats: Reserve 1 1/2 cups of the starchy pasta water before draining. Add the drained pasta directly to the skillet and toss to coat in the garlic-infused fat. Doing this off the heat prevents the eggs from scrambling and helps the pasta cool slightly for safe egg incorporation. Finish with egg mixture and starchy water: Quickly pour the beaten egg-cheese mixture over the hot pasta and toss energetically. Add 1 cup of reserved pasta water and continue tossing until the sauce thickens and glosses the noodles. If the sauce is too thick or clumps, add another 1/4 to 1/2 cup pasta water. Work briskly — the hot pasta cooks the eggs gently, creating a silky emulsion rather than scrambled curds. Plate and garnish: Transfer the pasta to a large serving bowl. Scatter the cooked bacon over the top, sprinkle the remaining 1/4 cup grated Pecorino Romano and finish with 1 to 2 tablespoons chopped fresh parsley. Serve immediately while warm and glossy. User provided content image 1

You Must Know

  • This will not reheat well; serve immediately. The emulsion relies on hot pasta and starchy water and can separate if chilled and reheated.
  • Timing and temperature are critical: have the egg mixture, reserved water and cheese ready before draining the pasta to avoid scrambling.
  • Use freshly grated Pecorino Romano for proper melt and flavor. Pre-grated shaker cheese contains anti-caking agents that prevent a smooth sauce.
  • Reserve more pasta water than you think you need. It is the key to adjusting sauce viscosity and preventing clumping.
  • This dish is higher in sodium because of cheese and cured pork; adjust salt in the pasta water accordingly if using very salty bacon or guanciale.

My favorite part of making this dish is the moment when the egg mixture transforms into a glossy coating as you toss the pasta. It feels almost magical and each time reminds me why classic techniques are worth the attention to detail. Family members always comment on the crispness of the bacon paired with the silky sauce; that contrast is what keeps this recipe on repeat in my kitchen.

Storage Tips

This preparation is best eaten immediately; if you have leftovers, store them in an airtight container in the refrigerator for up to 24 hours. Expect some separation—reheat gently in a wide skillet over low heat with a splash of water or milk, stirring constantly to coax the sauce back together. Avoid microwave reheating at high power, which will scramble the eggs. For freezing, it is not recommended because texture and emulsion will degrade significantly after thawing.

Ingredient Substitutions

If you cannot find Pecorino Romano, high-quality Parmigiano-Reggiano can be used, although flavor will be milder and less tangy. For a more authentic Roman profile, substitute guanciale or pancetta for bacon at a 1:1 weight ratio; reduce added salt because these cured meats can be saltier. To make a pork-free version, use smoked tempeh or roasted mushrooms for umami and texture. Note that any substitution alters the final flavor and may require minor salt adjustments.

User provided content image 2

Serving Suggestions

Serve this pasta family-style in a large shallow bowl to showcase the glossy sauce and crispy bacon. Complement with a peppery green salad, lemony roasted broccolini or simple oven-roasted tomatoes to cut the richness. Offer extra grated cheese and freshly cracked black pepper at the table. For wine pairings, a crisp white with good acidity such as Pinot Grigio or a light red like Chianti balances the salt and fat nicely.

Cultural Background

Carbonara traces its modern form to mid-20th century central Italy, with strong ties to Rome. Traditional versions use guanciale and Pecorino Romano rather than bacon and Parmigiano. The technique of creating a sauce from eggs and cheese without cream is a hallmark of Roman culinary skill, relying on the starch in pasta water to produce an emulsion. Over time, the recipe has evolved with regional and household variations around the world.

Seasonal Adaptations

In spring and summer, brighten the dish by adding blanched peas or fresh asparagus tips folded in at the end. In cooler months, fold in roasted squash or sautéed wild mushrooms for a deeper, earthier character. For holidays, finish with a scattering of toasted pine nuts and a few lemon zest shavings for freshness that cuts through the richness.

Meal Prep Tips

To streamline weeknight cooking, crisp the bacon and grate the cheese in advance and refrigerate separately for up to two days. Measure out the eggs and combine them with pepper and 1 cup cheese just before cooking to avoid moisture separation. Keep a small container of reserved pasta water in the fridge and warm it before use if you cook pasta ahead. Assemble and serve immediately for best texture.

Making this carbonara is a reminder that simple ingredients executed precisely produce exceptional results. Share it hot, and enjoy the quiet contentment when everyone at the table digs in. I hope this method becomes one of your reliable weeknight favorites as it has for my family.

Pro Tips

  • Bring eggs to room temperature so they emulsify more easily with hot pasta.

  • Reserve extra starchy pasta water; it is the key to adjusting sauce thickness without adding dairy.

  • Grate Pecorino Romano fresh from a wedge to avoid anti-caking agents that inhibit melting.

  • Work off the heat when combining eggs and pasta to prevent scrambling; use residual pasta heat to cook eggs gently.

This nourishing creamy carbonara pasta recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Dinner Mainscarbonarapastaitalianweeknightdinnerrecipecreamy
No ratings yet

Creamy Carbonara Pasta

This Creamy Carbonara Pasta recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 8 steaks
Creamy Carbonara Pasta
Prep:10 minutes
Cook:10 minutes
Rest Time:10 mins
Total:20 minutes

Instructions

1

Prepare the eggs and cheese

Whisk together 3 whole eggs, 3 additional yolks, 1/4 teaspoon black pepper and 1 cup grated Pecorino Romano in a medium bowl until smooth. Set aside near the stove so it can be added quickly to hot pasta.

2

Cook the pasta

Bring 10 cups water and 1 tablespoon salt to a rolling boil in an 8-quart pot. Add 16 ounces linguine and cook until al dente, about 9 to 11 minutes depending on brand. Reserve 1 to 1 1/2 cups starchy pasta water before draining.

3

Crisp the bacon

In a large 12-inch skillet over medium heat, cook 1/2 pound diced bacon for 9 to 11 minutes until golden and crispy. Remove with a slotted spoon to a bowl and leave the rendered fat in the skillet.

4

Infuse fat with garlic

Turn off the heat and add 2 teaspoons minced garlic to the warm rendered fat. Stir for about 1 minute until fragrant, allowing residual heat to soften the garlic without browning.

5

Combine pasta and sauce

Add drained pasta to the skillet and toss to coat. Quickly add the egg-cheese mixture and 1 cup reserved pasta water, tossing vigorously to create a glossy emulsion. Add additional pasta water 1/4 to 1/2 cup if needed to reach desired consistency.

6

Finish and serve

Transfer to a serving bowl, top with remaining 1/4 cup grated Pecorino Romano, cooked bacon crumbles and 1 to 2 tablespoons chopped fresh parsley. Serve immediately while hot.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 436kcal | Carbohydrates: 44g | Protein:
19g | Fat: 20g | Saturated Fat: 6g |
Polyunsaturated Fat: 4g | Monounsaturated Fat:
8g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@savoryte on social media!

Creamy Carbonara Pasta

Categories:

Creamy Carbonara Pasta

Did You Make This?

Leave a comment & rating below or tag @savoryte on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Sophia!

Chef and recipe creator specializing in delicious Dinner Mains cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.